PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_17983A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 423aa    MW: 46750.3 Da    PI: 6.7481
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_17983AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding569.2e-181461148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               +g W++eEde+l + ++++G g+W+t+++  g+ R++k+c++rw +yl
  Oropetium_20150105_17983A 14 KGLWSPEEDEKLMNHITKHGHGCWSTVPKLAGLQRCGKSCRLRWINYL 61
                               678*******************************************97 PP

2Myb_DNA-binding45.32e-1467109145
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                                rg+++++E++l++++++ lG++ W+ Ia +++ gRt++++k+ w+
  Oropetium_20150105_17983A  67 RGAFSQDEEDLIIELHAVLGNR-WSQIATRLP-GRTDNEIKNLWN 109
                                89********************.*********.*********998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-27664IPR009057Homeodomain-like
PROSITE profilePS5129424.586965IPR017930Myb domain
SuperFamilySSF466893.74E-2912108IPR009057Homeodomain-like
SMARTSM007176.5E-121363IPR001005SANT/Myb domain
PfamPF002495.4E-151461IPR001005SANT/Myb domain
CDDcd001679.41E-111761No hitNo description
Gene3DG3DSA:1.10.10.602.2E-2465116IPR009057Homeodomain-like
PROSITE profilePS5129419.86866116IPR017930Myb domain
SMARTSM007171.0E-1266114IPR001005SANT/Myb domain
PfamPF002492.9E-1367109IPR001005SANT/Myb domain
CDDcd001673.00E-969109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 423 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLMNHIT KHGHGCWSTV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGAF SQDEEDLIIE LHAVLGNRWS QIATRLPGRT DNEIKNLWNS SIKKKLRQKG  120
IDPNTHKLLS EVDRSKAAPT ISTERTSESS DVDPSSGGAI GSLNHLLSET AQSPELLPVL  180
GKHRKEITSL AHLRVPPKEL FLDQLVPGHD NLPTGRLTGP IPNFPFQQLS CYSNGFGSTN  240
SLWYNQNEAS GSAISTVMPP VSPSTLSTST GLNRSPDNQY SGGTAIQSTQ FHWDTTDPSS  300
SSSRGSSGSN GLGFELQGAS SLLENSVFPW TELATEKNSQ AHLEEELKWP DLLHGAFTET  360
PTTMQNLSQS LYEDVVKAES QFNMEGLCAA WSQNLQPPQH LQVVSDLYDK DLQRMSLSFE  420
SI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-28121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002457686.10.0hypothetical protein SORBIDRAFT_03g011640
TrEMBLC5XHY70.0C5XHY7_SORBI; Putative uncharacterized protein Sb03g011640
STRINGSb03g011640.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23103794
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.11e-89myb domain protein 61